PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 287aa    MW: 32196.8 Da    PI: 8.5578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
      Lus10023002 14 RGPWSPEEDAKLKDYIHKHGTGgNWIAFPHKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding38.82.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ +Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
      Lus10023002  69 GEFSDDEDRIICTLFANIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.042962IPR017930Myb domain
SuperFamilySSF466894.49E-2611109IPR009057Homeodomain-like
SMARTSM007176.2E-111364IPR001005SANT/Myb domain
PfamPF002493.2E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-241569IPR009057Homeodomain-like
CDDcd001672.13E-91662No hitNo description
PROSITE profilePS5129420.85863117IPR017930Myb domain
SMARTSM007171.7E-1167115IPR001005SANT/Myb domain
PfamPF002493.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRSPCCDKA NVKRGPWSPE EDAKLKDYIH KHGTGGNWIA FPHKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FSDDEDRIIC TLFANIGSRW SVIAAQLPGR TDNDIKNYWN TKLKKKLMGL  120
LPNPSHGRLP FHHPANFYPQ SSPLSSSVLS YSNNSSSSLS VDPSSMTSPI NPFKSNHGDY  180
NSSFNSTNAT MQRQQQPHYQ QQVKDGVLMF GSGGGTTEAS CSSSDGSSNI NVHHHHYRRQ  240
VNEFDYEAEQ LQQMSGFNQM EDYGFEEIKQ LVSTNSCCNN NSLLLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898416.12e-90PREDICTED: transcription factor RAX2
SwissprotQ9SJL74e-77RAX2_ARATH; Transcription factor RAX2
TrEMBLU5GA634e-89U5GA63_POPTR; Uncharacterized protein
TrEMBLW9RG965e-89W9RG96_9R
STRINGPOPTR_0006s12530.11e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.16e-77MYB family protein